PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00406g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 140aa    MW: 15547.9 Da    PI: 9.2229
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00406g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.72.7e-102415697
                              TTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                        B3 56 sgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                              ++r++lt+GW+ Fv+ ++L +gD vvF   +++++  +v+++
  Niben101Scf00406g00001.1  2 PRRHLLTNGWSAFVNGKKLVAGDLVVFL--REENGDVHVGFR 41
                              689*************************..446777788876 PP

2Auxin_resp36.32.4e-1367121157
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsser 57 
                               a++a++++ +F+v+ +P++  s+F+++++k+++a+++ + v m fkm  e  +s+er
  Niben101Scf00406g00001.1  67 ASDALASQRPFSVYCKPQT--SQFIISLNKYLEAINRGLGVSMTFKMPSEVANSHER 121
                               567999***********95..9*****************************999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.756144IPR003340B3 DNA binding domain
SuperFamilySSF1019361.44E-9242IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.7E-13252IPR015300DNA-binding pseudobarrel domain
PfamPF065076.6E-1167121IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
HPRRHLLTNG WSAFVNGKKL VAGDLVVFLR EENGDVHVGF RHLLCQKSSV EAPIASSLDI  60
KGVLEVASDA LASQRPFSVY CKPQTSQFII SLNKYLEAIN RGLGVSMTFK MPSEVANSHE  120
RYGVFRIYLT KNLSCLTDVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B8e-281121183306Auxin response factor 1
4ldw_A8e-281121183306Auxin response factor 1
4ldv_A8e-281121183306Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625169.12e-74PREDICTED: uncharacterized protein LOC104116082 isoform X2
RefseqXP_016459759.14e-74PREDICTED: uncharacterized protein LOC107783300 isoform X2
TrEMBLF6I6F35e-34F6I6F3_VITVI; Auxin response factor
TrEMBLM0ZGK27e-35M0ZGK2_SOLTU; Auxin response factor
STRINGVIT_15s0046g00290.t011e-33(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.23e-33auxin response factor 11